Review



pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences  (GenScript corporation)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    GenScript corporation pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences
    Pcd5 Expression Vectors Containing S1 Of Pigeon And Partridge Covs Codon Optimized S1 Sequences, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/pcd5+expression+vectors+containing+s1+of+pigeon+and+partridge+covs+codon+optimized+s1+sequences/pcd5+expression+vectors+containing+s1+of+pigeon+and+partridge+covs+codon+optimized+s1+sequences/pmc04452732-75-8-19
    Average 90 stars, based on 1 article reviews
    pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences - by Bioz Stars, 2026-10
    90/100 stars

    Images

    Related Articles

    Expressing:

    Article Title: Host Tissue and Glycan Binding Specificities of Avian Viral Attachment Proteins Using Novel Avian Tissue Microarrays
    Article Snippet: .. To generate pCD5 expression vectors containing S1 of pigeon and partridge CoVs codon optimized S1 sequences were obtained from GenScript (USA) and cloned using the introduced upstream Nhe I and downstream Pac I restriction sites into pCD5 expression plasmid by restriction digestion. .. The N- terminal CD5 signal peptide was followed by the S1 gene, and c- terminal GCN4 trimerization domain (GCN4; RMKQIEDKIEEIESKQKKIENEIARIKKLVPRGSLE) and the Strep -Tag II (ST;WSHPQFEK, IBA GmbH).

    Clone Assay:

    Article Title: Host Tissue and Glycan Binding Specificities of Avian Viral Attachment Proteins Using Novel Avian Tissue Microarrays
    Article Snippet: .. To generate pCD5 expression vectors containing S1 of pigeon and partridge CoVs codon optimized S1 sequences were obtained from GenScript (USA) and cloned using the introduced upstream Nhe I and downstream Pac I restriction sites into pCD5 expression plasmid by restriction digestion. .. The N- terminal CD5 signal peptide was followed by the S1 gene, and c- terminal GCN4 trimerization domain (GCN4; RMKQIEDKIEEIESKQKKIENEIARIKKLVPRGSLE) and the Strep -Tag II (ST;WSHPQFEK, IBA GmbH).

    Plasmid Preparation:

    Article Title: Host Tissue and Glycan Binding Specificities of Avian Viral Attachment Proteins Using Novel Avian Tissue Microarrays
    Article Snippet: .. To generate pCD5 expression vectors containing S1 of pigeon and partridge CoVs codon optimized S1 sequences were obtained from GenScript (USA) and cloned using the introduced upstream Nhe I and downstream Pac I restriction sites into pCD5 expression plasmid by restriction digestion. .. The N- terminal CD5 signal peptide was followed by the S1 gene, and c- terminal GCN4 trimerization domain (GCN4; RMKQIEDKIEEIESKQKKIENEIARIKKLVPRGSLE) and the Strep -Tag II (ST;WSHPQFEK, IBA GmbH).



    Similar Products

    pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences  (GenScript corporation)
    90
    GenScript corporation pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences
    Pcd5 Expression Vectors Containing S1 Of Pigeon And Partridge Covs Codon Optimized S1 Sequences, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/pcd5+expression+vectors+containing+s1+of+pigeon+and+partridge+covs+codon+optimized+s1+sequences/pcd5+expression+vectors+containing+s1+of+pigeon+and+partridge+covs+codon+optimized+s1+sequences/pmc04452732-75-8-19
    Average 90 stars, based on 1 article reviews
    pcd5 expression vectors containing s1 of pigeon and partridge covs codon optimized s1 sequences - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier

    Image Search Results